SCOPe 2.06: Domain d1etzb1: 1etz B:1-126

Lineage for d1etzb1 (1etz B:1-126)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
   SQ NA # part of Fab 28 against HIV-1 RT

8. Domain d1etzb1: 1etz B:1-126 [20481]
   Other proteins in same PDB: d1etza1, d1etza2, d1etzb2, d1etzh2, d1etzl1, d1etzl2
   part of anti-sweetener Fab NC10.14
   complexed with gas

Details for d1etzb1

PDB Entry: 1etz, 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

PDB Compounds: (B:) fab nc10.14 - heavy chain

SCOPe Domain Sequences for d1etzb1:

Sequence; same for both SEQRES and ATOM records:

>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
tltvss

Timeline for d1etzb1:

• d1etzb1 first appeared (with stable ids) in SCOP 1.55
  
• d1etzb1 appears in SCOPe 2.05
  
• d1etzb1 appears in SCOPe 2.07
  
• d1etzb1 appears in the current release, SCOPe 2.08