![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [48904] (1 PDB entry) |
![]() | Domain d1etzb1: 1etz B:1-126 [20481] Other proteins in same PDB: d1etza2, d1etzb2, d1etzh2, d1etzl2 |
PDB Entry: 1etz (more details), 2.6 Å
SCOP Domain Sequences for d1etzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin (variable domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain} qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt tltvss
Timeline for d1etzb1: