Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries) |
Domain d2iikb1: 2iik B:30-297 [204790] Other proteins in same PDB: d2iikb3 automated match to d1wdkc1 |
PDB Entry: 2iik (more details), 2.55 Å
SCOPe Domain Sequences for d2iikb1:
Sequence, based on SEQRES records: (download)
>d2iikb1 c.95.1.0 (B:30-297) automated matches {Human (Homo sapiens) [TaxId: 9606]} apqasaadvvvvhgrrtaicragrggfkdttpdellsavmtavlkdvnlrpeqlgdicvg nvlqpgagaimariaqflsdipetvplstvnrqcssglqavasiaggirngsydigmacg vesmsladrgnpgnitsrlmekekardclipmgitsenvaerfgisrekqdtfalasqqk aaraqskgcfqaeivpvtttvhddkgtkrsitvtqdegirpsttmeglaklkpafkkdgs ttagnssqvsdgaaaillarrskaeel
>d2iikb1 c.95.1.0 (B:30-297) automated matches {Human (Homo sapiens) [TaxId: 9606]} apqasaadvvvvhgrrtaicragrggfkdttpdellsavmtavlkdvnlrpeqlgdicvg nvlqpgagaimariaqflsdipetvplstvnrqcssglqavasiaggirngsydigmacg vesmslapgnitsrlmekekardclipmgitsenvaerfgisrekqdtfalasqqkaara qskgcfqaeivpvtttvhddkgtkrsitvtqdegirpsttmeglaklkpafkkdgsttag nssqvsdgaaaillarrskaeel
Timeline for d2iikb1: