SCOPe 2.06: Domain d2iika2: 2iik A:298-423

Lineage for d2iika2 (2iik A:298-423)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)

8. Domain d2iika2: 2iik A:298-423 [204789]
   Other proteins in same PDB: d2iikb3
   automated match to d1wdkc2

Details for d2iika2

PDB Entry: 2iik, 2.55 Å

PDB Description: Crystal Structure of human peroxisomal acetyl-CoA acyl transferase 1 (ACAA1)

PDB Compounds: (A:) 3-ketoacyl-CoA thiolase, peroxisomal

SCOPe Domain Sequences for d2iika2:

Sequence; same for both SEQRES and ATOM records:

>d2iika2 c.95.1.0 (A:298-423) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glpilgvlrsyavvgvppdimgigpayaipvalqkagltvsdvdifeineafasqaaycv
eklrlppekvnplggavalghplgctgarqvitllnelkrrgkraygvvsmcigtgmgaa
avfeyp

Timeline for d2iika2:

• d2iika2 first appeared in SCOPe 2.03
  
• d2iika2 appears in SCOPe 2.05
  
• d2iika2 appears in SCOPe 2.07
  
• d2iika2 appears in the current release, SCOPe 2.08