SCOPe 2.05: Domain d2ih3c_: 2ih3 C:

Lineage for d2ih3c_ (2ih3 C:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)

8. Domain d2ih3c_: 2ih3 C: [204786]
   Other proteins in same PDB: d2ih3a1, d2ih3a2, d2ih3b1, d2ih3b2
   automated match to d1s5hc_
   complexed with 1em, k

Details for d2ih3c_

PDB Entry: 2ih3, 1.72 Å

PDB Description: ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2ih3c_:

Sequence; same for both SEQRES and ATOM records:

>d2ih3c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvaygdlyp
vtlwgrlvavvvmvagitsfglvtaalatwfvgreqer

Timeline for d2ih3c_:

• d2ih3c_ first appeared in SCOPe 2.03
  
• d2ih3c_ appears in SCOPe 2.04
  
• d2ih3c_ appears in SCOPe 2.06
  
• d2ih3c_ appears in the current release, SCOPe 2.08