Lineage for d1etzl1 (1etz L:1-110)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512286Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1512377Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries)
  8. 1512403Domain d1etzl1: 1etz L:1-110 [20478]
    Other proteins in same PDB: d1etza2, d1etzb1, d1etzb2, d1etzh1, d1etzh2, d1etzl2
    part of anti-sweetener Fab NC10.14
    complexed with gas

Details for d1etzl1

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
PDB Compounds: (L:) fab nc10.14 - light chain

SCOPe Domain Sequences for d1etzl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzl1 b.1.1.1 (L:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOPe Domain Coordinates for d1etzl1:

Click to download the PDB-style file with coordinates for d1etzl1.
(The format of our PDB-style files is described here.)

Timeline for d1etzl1: