Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [48904] (1 PDB entry) |
Domain d1etzl1: 1etz L:1-110 [20478] Other proteins in same PDB: d1etza2, d1etzb2, d1etzh2, d1etzl2 |
PDB Entry: 1etz (more details), 2.6 Å
SCOP Domain Sequences for d1etzl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etzl1 b.1.1.1 (L:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain} favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlg
Timeline for d1etzl1: