Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d2ialc2: 2ial C:110-198 [204769] Other proteins in same PDB: d2iala1, d2ialb1, d2ialc1, d2iald1 automated match to d1qrnd2 mutant |
PDB Entry: 2ial (more details), 1.92 Å
SCOPe Domain Sequences for d2ialc2:
Sequence, based on SEQRES records: (download)
>d2ialc2 b.1.1.2 (C:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d2ialc2 b.1.1.2 (C:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava wsnksdfacanafnnsiipedtffps
Timeline for d2ialc2: