SCOPe 2.07: Domain d2ialc1: 2ial C:1-109

Lineage for d2ialc1 (2ial C:1-109)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2ialc1: 2ial C:1-109 [204768]
   Other proteins in same PDB: d2iala2, d2ialb2, d2ialc2, d2iald2
   automated match to d1qrnd1
   mutant

Details for d2ialc1

PDB Entry: 2ial, 1.92 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR

PDB Compounds: (C:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2ialc1:

Sequence; same for both SEQRES and ATOM records:

>d2ialc1 b.1.1.0 (C:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpn

Timeline for d2ialc1:

• d2ialc1 first appeared in SCOPe 2.03
  
• d2ialc1 appears in SCOPe 2.06
  
• d2ialc1 appears in the current release, SCOPe 2.08