Lineage for d1c5bl1 (1c5b L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511994Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (213 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 1512064Domain d1c5bl1: 1c5b L:1-107 [20476]
    Other proteins in same PDB: d1c5bh1, d1c5bh2, d1c5bl2
    part of humanized catalytic Fab 21D8 with a decarboxylase activity

Details for d1c5bl1

PDB Entry: 1c5b (more details), 2.1 Å

PDB Description: decarboxylase catalytic antibody 21d8 unliganded form
PDB Compounds: (L:) chimeric decarboxylase antibody 21d8

SCOPe Domain Sequences for d1c5bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5bl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleik

SCOPe Domain Coordinates for d1c5bl1:

Click to download the PDB-style file with coordinates for d1c5bl1.
(The format of our PDB-style files is described here.)

Timeline for d1c5bl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5bl2