Lineage for d1c5bl1 (1c5b L:1-107)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102318Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [48903] (2 PDB entries)
  8. 102322Domain d1c5bl1: 1c5b L:1-107 [20476]
    Other proteins in same PDB: d1c5bh2, d1c5bl2

Details for d1c5bl1

PDB Entry: 1c5b (more details), 2.1 Å

PDB Description: decarboxylase catalytic antibody 21d8 unliganded form

SCOP Domain Sequences for d1c5bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5bl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)}
eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleik

SCOP Domain Coordinates for d1c5bl1:

Click to download the PDB-style file with coordinates for d1c5bl1.
(The format of our PDB-style files is described here.)

Timeline for d1c5bl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5bl2