SCOPe 2.03: Domain d2i9pc2: 2i9p C:202-332

Lineage for d2i9pc2 (2i9p C:202-332)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (10 PDB entries)

8. Domain d2i9pc2: 2i9p C:202-332 [204757]
   Other proteins in same PDB: d2i9pa1, d2i9pb1, d2i9pc1, d2i9pd1
   automated match to d2cvza1
   complexed with nad

Details for d2i9pc2

PDB Entry: 2i9p, 2.55 Å

PDB Description: crystal structure of human hydroxyisobutyrate dehydrogenase complexed with nad+

PDB Compounds: (C:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2i9pc2:

Sequence; same for both SEQRES and ATOM records:

>d2i9pc2 a.100.1.0 (C:202-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp
gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk
dfssvfqflre

Timeline for d2i9pc2:

• d2i9pc2 is new in SCOPe 2.03-stable
  
• d2i9pc2 appears in SCOPe 2.04
  
• d2i9pc2 appears in the current release, SCOPe 2.08