SCOPe 2.05: Domain d2i8cb1: 2i8c B:3-128

Lineage for d2i8cb1 (2i8c B:3-128)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (28 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225143] (2 PDB entries)

8. Domain d2i8cb1: 2i8c B:3-128 [204752]
   Other proteins in same PDB: d2i8ca2, d2i8cb2
   automated match to d1ehib1
   complexed with adp, mg, so4

Details for d2i8cb1

PDB Entry: 2i8c, 2.46 Å

PDB Description: Allosteric inhibition of Staphylococcus aureus D-alanine:D-alanine ligase revealed by crystallographic studies

PDB Compounds: (B:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2i8cb1:

Sequence; same for both SEQRES and ATOM records:

>d2i8cb1 c.30.1.0 (B:3-128) automated matches {Staphylococcus aureus [TaxId: 93062]}
kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst
delhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngvl
saassm

Timeline for d2i8cb1:

• d2i8cb1 first appeared in SCOPe 2.03
  
• d2i8cb1 appears in SCOPe 2.04
  
• d2i8cb1 appears in SCOPe 2.06
  
• d2i8cb1 appears in the current release, SCOPe 2.08