Lineage for d2i87a1 (2i87 A:3-128)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360440Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1360441Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1360707Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1360708Protein automated matches [226903] (19 species)
    not a true protein
  7. 1360749Species Staphylococcus aureus [TaxId:93062] [225143] (2 PDB entries)
  8. 1360750Domain d2i87a1: 2i87 A:3-128 [204746]
    Other proteins in same PDB: d2i87a2, d2i87b2
    automated match to d1ehib1
    complexed with so4

Details for d2i87a1

PDB Entry: 2i87 (more details), 2 Å

PDB Description: Allosteric inhibition of Staphylococcus aureus D-alanine:D-alanine ligase revealed by crystallographic studies
PDB Compounds: (A:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2i87a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i87a1 c.30.1.0 (A:3-128) automated matches {Staphylococcus aureus [TaxId: 93062]}
kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst
delhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngvl
saassm

SCOPe Domain Coordinates for d2i87a1:

Click to download the PDB-style file with coordinates for d2i87a1.
(The format of our PDB-style files is described here.)

Timeline for d2i87a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i87a2