SCOPe 2.05: Domain d2i80b2: 2i80 B:129-360

Lineage for d2i80b2 (2i80 B:129-360)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (27 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225146] (3 PDB entries)

8. Domain d2i80b2: 2i80 B:129-360 [204740]
   Other proteins in same PDB: d2i80a1, d2i80b1
   automated match to d1ehib2
   complexed with g1l

Details for d2i80b2

PDB Entry: 2i80, 2.19 Å

PDB Description: Allosteric inhibition of Staphylococcus aureus D-alanine:D-alanine ligase revealed by crystallographic studies

PDB Compounds: (B:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2i80b2:

Sequence, based on SEQRES records:

>d2i80b2 d.142.1.0 (B:129-360) automated matches {Staphylococcus aureus [TaxId: 1280]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafydy
kskykdgkvqlqipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetn
ampgftafsmypklwenmglsypelitklielakerhqdkqknkykidrshh

Sequence, based on observed residues (ATOM records):

>d2i80b2 d.142.1.0 (B:129-360) automated matches {Staphylococcus aureus [TaxId: 1280]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafvql
qipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetnampgftafsmy
pklwenmglsypelitklielakerhqdkqknkykidrshh

Timeline for d2i80b2:

• d2i80b2 first appeared in SCOPe 2.03
  
• d2i80b2 appears in SCOPe 2.04
  
• d2i80b2 appears in SCOPe 2.06
  
• d2i80b2 appears in the current release, SCOPe 2.08