SCOP 1.57: Domain d1c5cl1: 1c5c L:1-107

Lineage for d1c5cl1 (1c5c L:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [48903] (2 PDB entries)

8. Domain d1c5cl1: 1c5c L:1-107 [20474]
   Other proteins in same PDB: d1c5ch2, d1c5cl2

Details for d1c5cl1

PDB Entry: 1c5c, 1.61 Å

PDB Description: decarboxylase catalytic antibody 21d8-hapten complex

SCOP Domain Sequences for d1c5cl1:

Sequence; same for both SEQRES and ATOM records:

>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)}
eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleik

Timeline for d1c5cl1:

• d1c5cl1 first appeared (with stable ids) in SCOP 1.55
  
• d1c5cl1 appears in SCOP 1.59
  
• d1c5cl1 appears in the current release, SCOPe 2.08