Lineage for d1fskl1 (1fsk L:1-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 218975Species Anti-bet v1 Fab BV16, (mouse), kappa L chain [48902] (1 PDB entry)
  8. 218983Domain d1fskl1: 1fsk L:1-118 [20473]
    Other proteins in same PDB: d1fska_, d1fskb2, d1fskc2, d1fskd_, d1fske2, d1fskf2, d1fskg_, d1fskh2, d1fski2, d1fskj_, d1fskk2, d1fskl2

Details for d1fskl1

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fskl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskl1 b.1.1.1 (L:1-118) Immunoglobulin (variable domains of L and H chains) {Anti-bet v1 Fab BV16, (mouse), kappa L chain}
qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsv

SCOP Domain Coordinates for d1fskl1:

Click to download the PDB-style file with coordinates for d1fskl1.
(The format of our PDB-style files is described here.)

Timeline for d1fskl1: