Lineage for d2i6ta2 (2i6t A:319-471)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233238Species Human (Homo sapiens) [TaxId:9606] [225157] (2 PDB entries)
  8. 2233239Domain d2i6ta2: 2i6t A:319-471 [204726]
    Other proteins in same PDB: d2i6ta1, d2i6tb1
    automated match to d1ez4a2
    complexed with gol, so4

Details for d2i6ta2

PDB Entry: 2i6t (more details), 2.1 Å

PDB Description: orthorhombic structure of the ldh domain of human ubiquitin- conjugating enzyme e2-like isoform a
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-like isoform a

SCOPe Domain Sequences for d2i6ta2:

Sequence, based on SEQRES records: (download)

>d2i6ta2 d.162.1.0 (A:319-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsgqeevvshtsqvqlsnrame
llrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevflslpcilgtngv
sevikttlkedtvteklqssassihslqqqlkl

Sequence, based on observed residues (ATOM records): (download)

>d2i6ta2 d.162.1.0 (A:319-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsgqeevvshtsqvqlsnrame
llrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevflslpcilgtngv
sevikttledtvteklqssassihslqqqlkl

SCOPe Domain Coordinates for d2i6ta2:

Click to download the PDB-style file with coordinates for d2i6ta2.
(The format of our PDB-style files is described here.)

Timeline for d2i6ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i6ta1