Lineage for d1fskk1 (1fsk K:1-107)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 101996Species Anti bet v1 Fab BV16, (mouse), kappa L chain [48902] (1 PDB entry)
  8. 102003Domain d1fskk1: 1fsk K:1-107 [20472]
    Other proteins in same PDB: d1fska_, d1fskb2, d1fskc2, d1fskd_, d1fske2, d1fskf2, d1fskg_, d1fskh2, d1fski2, d1fskj_, d1fskk2, d1fskl2

Details for d1fskk1

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fskk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskk1 b.1.1.1 (K:1-107) Immunoglobulin (variable domains of L and H chains) {Anti bet v1 Fab BV16, (mouse), kappa L chain}
nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleik

SCOP Domain Coordinates for d1fskk1:

Click to download the PDB-style file with coordinates for d1fskk1.
(The format of our PDB-style files is described here.)

Timeline for d1fskk1: