SCOPe 2.08: Domain d2i3zb1: 2i3z B:38-509

Lineage for d2i3zb1 (2i3z B:38-509)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein automated matches [226889] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (8 PDB entries)

8. Domain d2i3zb1: 2i3z B:38-509 [204700]
   Other proteins in same PDB: d2i3za2, d2i3zb2
   automated match to d1orva1
   complexed with lir

Details for d2i3zb1

PDB Entry: 2i3z, 2.9 Å

PDB Description: rat dpp-iv with xanthine mimetic inhibitor #7

PDB Compounds: (B:) Dipeptidyl peptidase 4 (Dipeptidyl peptidase IV) (DPP IV)

SCOPe Domain Sequences for d2i3zb1:

Sequence; same for both SEQRES and ATOM records:

>d2i3zb1 b.70.3.1 (B:38-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rrtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifg
dsisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsq
eghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspn
gtflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsst
tttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwnc
pttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctf
itkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqy
ysvslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq

Timeline for d2i3zb1:

• d2i3zb1 first appeared in SCOPe 2.03
  
• d2i3zb1 appears in SCOPe 2.07