SCOPe 2.05: Domain d1fskh1: 1fsk H:1-107

Lineage for d1fskh1 (1fsk H:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (213 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d1fskh1: 1fsk H:1-107 [20470]
   Other proteins in same PDB: d1fska_, d1fskb2, d1fskc1, d1fskc2, d1fskd_, d1fske2, d1fskf1, d1fskf2, d1fskg_, d1fskh2, d1fski1, d1fski2, d1fskj_, d1fskk2, d1fskl1, d1fskl2
   part of anti-bet v1 Fab BV16

Details for d1fskh1

PDB Entry: 1fsk, 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

PDB Compounds: (H:) immunoglobulin kappa light chain

SCOPe Domain Sequences for d1fskh1:

Sequence; same for both SEQRES and ATOM records:

>d1fskh1 b.1.1.1 (H:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleik

Timeline for d1fskh1:

• d1fskh1 first appeared (with stable ids) in SCOP 1.55
  
• d1fskh1 appears in SCOPe 2.04
  
• d1fskh1 appears in SCOPe 2.06
  
• d1fskh1 appears in the current release, SCOPe 2.08