SCOP 1.63: Domain d1fskf1: 1fsk F:1-118

Lineage for d1fskf1 (1fsk F:1-118)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-bet v1 Fab BV16, (mouse), kappa L chain [48902] (1 PDB entry)

8. Domain d1fskf1: 1fsk F:1-118 [20469]
   Other proteins in same PDB: d1fska_, d1fskb2, d1fskc2, d1fskd_, d1fske2, d1fskf2, d1fskg_, d1fskh2, d1fski2, d1fskj_, d1fskk2, d1fskl2

Details for d1fskf1

PDB Entry: 1fsk, 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fskf1:

Sequence; same for both SEQRES and ATOM records:

>d1fskf1 b.1.1.1 (F:1-118) Immunoglobulin (variable domains of L and H chains) {Anti-bet v1 Fab BV16, (mouse), kappa L chain}
qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsv

Timeline for d1fskf1:

• d1fskf1 first appeared (with stable ids) in SCOP 1.55
  
• d1fskf1 appears in SCOP 1.61
  
• d1fskf1 appears in SCOP 1.65
  
• d1fskf1 appears in the current release, SCOPe 2.08