Lineage for d2hwpb_ (2hwp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979972Protein c-src tyrosine kinase [56155] (3 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2979973Species Chicken (Gallus gallus) [TaxId:9031] [56157] (56 PDB entries)
  8. 2980046Domain d2hwpb_: 2hwp B: [204654]
    automated match to d2gqgb_
    complexed with djk

Details for d2hwpb_

PDB Entry: 2hwp (more details), 2.48 Å

PDB Description: crystal structure of src kinase domain in complex with covalent inhibitor pd168393
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d2hwpb_:

Sequence, based on SEQRES records: (download)

>d2hwpb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
rheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayv
ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg
rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq
cwrkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d2hwpb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgevwmgtwngttrvaiktlqvmkklrheklvqlyavvseepi
yivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraanilv
genlvckvafpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldq
vergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl

SCOPe Domain Coordinates for d2hwpb_:

Click to download the PDB-style file with coordinates for d2hwpb_.
(The format of our PDB-style files is described here.)

Timeline for d2hwpb_: