Lineage for d1fh5h1 (1fh5 H:4-120)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102803Species Fab MAK33, (human), kappa L chain [48901] (1 PDB entry)
  8. 102804Domain d1fh5h1: 1fh5 H:4-120 [20465]
    Other proteins in same PDB: d1fh5h2, d1fh5l2

Details for d1fh5h1

PDB Entry: 1fh5 (more details), 2.9 Å

PDB Description: crystal structure of the fab fragment of the monoclonal antibody mak33

SCOP Domain Sequences for d1fh5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fh5h1 b.1.1.1 (H:4-120) Immunoglobulin (variable domains of L and H chains) {Fab MAK33, (human), kappa L chain}
sggglvkpagslklscaasgftfssyymywvrqtpdkrlewvatisdggsytyypdsvkg
rftisrdnaknnlylqmsslksedtamyycardamdywgqgtlvtvsa

SCOP Domain Coordinates for d1fh5h1:

Click to download the PDB-style file with coordinates for d1fh5h1.
(The format of our PDB-style files is described here.)

Timeline for d1fh5h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fh5h2