SCOP 1.55: Domain d1fh5h1: 1fh5 H:4-120

Lineage for d1fh5h1 (1fh5 H:4-120)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab MAK33, (human), kappa L chain [48901] (1 PDB entry)
8. Domain d1fh5h1: 1fh5 H:4-120 [20465]
   Other proteins in same PDB: d1fh5h2, d1fh5l2

Details for d1fh5h1

PDB Entry: 1fh5, 2.9 Å

PDB Description: crystal structure of the fab fragment of the monoclonal antibody mak33

SCOP Domain Sequences for d1fh5h1:

Sequence; same for both SEQRES and ATOM records:

>d1fh5h1 b.1.1.1 (H:4-120) Immunoglobulin (variable domains of L and H chains) {Fab MAK33, (human), kappa L chain}
sggglvkpagslklscaasgftfssyymywvrqtpdkrlewvatisdggsytyypdsvkg
rftisrdnaknnlylqmsslksedtamyycardamdywgqgtlvtvsa

SCOP Domain Coordinates for d1fh5h1 are not available.

Timeline for d1fh5h1:

• d1fh5h1 appears in SCOP 1.57
  
• d1fh5h1 appears in the current release, SCOPe 2.08