Lineage for d1fh5h1 (1fh5 H:4-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740136Domain d1fh5h1: 1fh5 H:4-120 [20465]
    Other proteins in same PDB: d1fh5h2, d1fh5l1, d1fh5l2
    part of Fab MAK33; conflict: annotated in PDB as human protein

Details for d1fh5h1

PDB Entry: 1fh5 (more details), 2.9 Å

PDB Description: crystal structure of the fab fragment of the monoclonal antibody mak33
PDB Compounds: (H:) monoclonal antibody mak33

SCOPe Domain Sequences for d1fh5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fh5h1 b.1.1.1 (H:4-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
sggglvkpagslklscaasgftfssyymywvrqtpdkrlewvatisdggsytyypdsvkg
rftisrdnaknnlylqmsslksedtamyycardamdywgqgtlvtvsa

SCOPe Domain Coordinates for d1fh5h1:

Click to download the PDB-style file with coordinates for d1fh5h1.
(The format of our PDB-style files is described here.)

Timeline for d1fh5h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fh5h2