SCOP 1.71: Domain d1f3dk1: 1f3d K:1-121

Lineage for d1f3dk1 (1f3d K:1-121)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1f3dk1: 1f3d K:1-121 [20463]
   Other proteins in same PDB: d1f3dh2, d1f3dj1, d1f3dj2, d1f3dk2, d1f3dl1, d1f3dl2
   part of catalytic Fab 4B2
   complexed with so4, tpm

Details for d1f3dk1

PDB Entry: 1f3d, 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dk1:

Sequence; same for both SEQRES and ATOM records:

>d1f3dk1 b.1.1.1 (K:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvss

Timeline for d1f3dk1:

• d1f3dk1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3dk1 appears in SCOP 1.69
  
• d1f3dk1 appears in SCOP 1.73
  
• d1f3dk1 appears in the current release, SCOPe 2.08