SCOP 1.59: Domain d1f3dk1: 1f3d K:1-121

Lineage for d1f3dk1 (1f3d K:1-121)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Catalytic Fab 4B2, (mouse), kappa L chain [48900] (1 PDB entry)

8. Domain d1f3dk1: 1f3d K:1-121 [20463]
   Other proteins in same PDB: d1f3dh2, d1f3dj2, d1f3dk2, d1f3dl2

Details for d1f3dk1

PDB Entry: 1f3d, 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dk1:

Sequence; same for both SEQRES and ATOM records:

>d1f3dk1 b.1.1.1 (K:1-121) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 4B2, (mouse), kappa L chain}
eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvss

Timeline for d1f3dk1:

• d1f3dk1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3dk1 appears in SCOP 1.57
  
• d1f3dk1 appears in SCOP 1.61
  
• d1f3dk1 appears in the current release, SCOPe 2.08