Lineage for d1f11d1 (1f11 D:1-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219168Species Anti-Pres2 Fab F124, (mouse), kappa L chain [48899] (1 PDB entry)
  8. 219172Domain d1f11d1: 1f11 D:1-113 [20459]
    Other proteins in same PDB: d1f11a2, d1f11b2, d1f11c2, d1f11d2

Details for d1f11d1

PDB Entry: 1f11 (more details), 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f11d1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-Pres2 Fab F124, (mouse), kappa L chain}
evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsa

SCOP Domain Coordinates for d1f11d1:

Click to download the PDB-style file with coordinates for d1f11d1.
(The format of our PDB-style files is described here.)

Timeline for d1f11d1: