Lineage for d2hjri2 (2hjr I:155-325)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 2557474Species Cryptosporidium parvum [TaxId:5807] [225105] (1 PDB entry)
  8. 2557483Domain d2hjri2: 2hjr I:155-325 [204583]
    Other proteins in same PDB: d2hjra1, d2hjrb1, d2hjrc1, d2hjrd1, d2hjre1, d2hjrf1, d2hjrg1, d2hjrh1, d2hjri1, d2hjrj1, d2hjrk1, d2hjrl1
    automated match to d5ldha2
    complexed with apr, cit

Details for d2hjri2

PDB Entry: 2hjr (more details), 2.2 Å

PDB Description: Crystal Structure of Cryptosporidium parvum malate dehydrogenase
PDB Compounds: (I:) malate dehydrogenase

SCOPe Domain Sequences for d2hjri2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjri2 d.162.1.0 (I:155-325) automated matches {Cryptosporidium parvum [TaxId: 5807]}
msgvldsarfrcnlsralgvkpsdvsaivvgghgdemipltssvtiggillsdfveqgki
thsqineiikktafgggeivellktgsafyapaasavamaqaylkdsksvlvcstyltgq
ynvnnlfvgvpvvigkngiedvvivnlsddekslfsksvesiqnlvqdlks

SCOPe Domain Coordinates for d2hjri2:

Click to download the PDB-style file with coordinates for d2hjri2.
(The format of our PDB-style files is described here.)

Timeline for d2hjri2: