Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Anti-Pres2 Fab F124, (mouse), kappa L chain [48899] (1 PDB entry) |
Domain d1f11b1: 1f11 B:1-113 [20457] Other proteins in same PDB: d1f11a2, d1f11b2, d1f11c2, d1f11d2 |
PDB Entry: 1f11 (more details), 3 Å
SCOP Domain Sequences for d1f11b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f11b1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-Pres2 Fab F124, (mouse), kappa L chain} evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsa
Timeline for d1f11b1: