Lineage for d1f11a1 (1f11 A:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51818Species Anti-Pres2 Fab F124, (mouse), kappa L chain [48899] (1 PDB entry)
  8. 51819Domain d1f11a1: 1f11 A:1-107 [20456]
    Other proteins in same PDB: d1f11a2, d1f11b2, d1f11c2, d1f11d2

Details for d1f11a1

PDB Entry: 1f11 (more details), 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f11a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-Pres2 Fab F124, (mouse), kappa L chain}
dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleik

SCOP Domain Coordinates for d1f11a1:

Click to download the PDB-style file with coordinates for d1f11a1.
(The format of our PDB-style files is described here.)

Timeline for d1f11a1: