SCOPe 2.08: Domain d2hiic1: 2hii C:1-126

Lineage for d2hiic1 (2hii C:1-126)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetry
Superfamily d.131.1: DNA clamp [55979] (3 families)
Family d.131.1.0: automated matches [227185] (1 protein)
not a true family
Protein automated matches [226907] (28 species)
not a true protein
Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)
Domain d2hiic1: 2hii C:1-126 [204554]
automated match to d1ud9a1

Details for d2hiic1

PDB Entry: 2hii (more details), 2.79 Å

PDB Description: heterotrimeric pcna sliding clamp

PDB Compounds: (C:) pcna3 (sso0405)

SCOPe Domain Sequences for d2hiic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiic1 d.131.1.0 (C:1-126) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mkvvyddvrvlkdiiqalarlvdeavlkfkqdsvelvaldrahislisvnlpremfkeyd
vndefkfgfntqylmkilkvakrkeaieiasespdsviiniigstnrefnvrnlevseqe
ipeinl

SCOPe Domain Coordinates for d2hiic1:

Click to download the PDB-style file with coordinates for d2hiic1.
(The format of our PDB-style files is described here.)

Timeline for d2hiic1: