Lineage for d1f4yh1 (1f4y H:1-117)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102029Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [48898] (3 PDB entries)
  8. 102034Domain d1f4yh1: 1f4y H:1-117 [20455]
    Other proteins in same PDB: d1f4yh2, d1f4yl2

Details for d1f4yh1

PDB Entry: 1f4y (more details), 2.8 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4yh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4yh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
evqleesggglvtpggslrlscaasgyvfstydmswvrqtpekrlewvafissgggrtsy
pdtvkgrftisrddakntlylqmsslqsedtamyyctrhfyavldywgrgttltvss

SCOP Domain Coordinates for d1f4yh1:

Click to download the PDB-style file with coordinates for d1f4yh1.
(The format of our PDB-style files is described here.)

Timeline for d1f4yh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4yh2