SCOPe 2.04: Domain d2hdba2: 2hdb A:168-383

Lineage for d2hdba2 (2hdb A:168-383)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species)
   most similar to FabH

7. Species Enterococcus faecalis [TaxId:1351] [225034] (4 PDB entries)

8. Domain d2hdba2: 2hdb A:168-383 [204541]
   automated match to d1xpma2
   complexed with mes, so4; mutant

Details for d2hdba2

PDB Entry: 2hdb, 2.2 Å

PDB Description: hmg-coa synthase from enterococcus faecalis. mutation alanine 110 to glycine

PDB Compounds: (A:) HMG-CoA synthase

SCOPe Domain Sequences for d2hdba2:

Sequence; same for both SEQRES and ATOM records:

>d2hdba2 c.95.1.2 (A:168-383) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Enterococcus faecalis [TaxId: 1351]}
ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady
dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis
llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey
eamfaetldtdidqtledelkysisainntvrsyrn

Timeline for d2hdba2:

• d2hdba2 first appeared in SCOPe 2.03
  
• d2hdba2 appears in SCOPe 2.05
  
• d2hdba2 appears in the current release, SCOPe 2.08