Lineage for d1f4wl1 (1f4w L:1-110)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354589Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2354681Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2354696Domain d1f4wl1: 1f4w L:1-110 [20452]
    Other proteins in same PDB: d1f4wh1, d1f4wh2, d1f4wl2
    part of anti-carbohydrate Fab S-20-4

Details for d1f4wl1

PDB Entry: 1f4w (more details), 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
PDB Compounds: (L:) antibody s-20-4, fab fragment, light chain

SCOPe Domain Sequences for d1f4wl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4wl1 b.1.1.1 (L:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgtvttsnyanwvqekpdhlftgligatnnraagv
pvrfsgsliggkaaltitgaqtedeaiyfcalwysghwvfgggtkltvlg

SCOPe Domain Coordinates for d1f4wl1:

Click to download the PDB-style file with coordinates for d1f4wl1.
(The format of our PDB-style files is described here.)

Timeline for d1f4wl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4wl2