SCOPe 2.08: Domain d1f4wl1: 1f4w L:1-110

Lineage for d1f4wl1 (1f4w L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)

8. Domain d1f4wl1: 1f4w L:1-110 [20452]
   Other proteins in same PDB: d1f4wh1, d1f4wh2, d1f4wl2
   part of anti-carbohydrate Fab S-20-4

Details for d1f4wl1

PDB Entry: 1f4w, 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

PDB Compounds: (L:) antibody s-20-4, fab fragment, light chain

SCOPe Domain Sequences for d1f4wl1:

Sequence; same for both SEQRES and ATOM records:

>d1f4wl1 b.1.1.1 (L:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgtvttsnyanwvqekpdhlftgligatnnraagv
pvrfsgsliggkaaltitgaqtedeaiyfcalwysghwvfgggtkltvlg

Timeline for d1f4wl1:

• d1f4wl1 first appeared (with stable ids) in SCOP 1.55
  
• d1f4wl1 appears in SCOPe 2.07