Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [48898] (3 PDB entries) |
Domain d1f4xh1: 1f4x H:1-117 [20451] Other proteins in same PDB: d1f4xh2, d1f4xl2 |
PDB Entry: 1f4x (more details), 2.3 Å
SCOP Domain Sequences for d1f4xh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4xh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain} evqleesggglvtpggslrlscaasgyvfstydmswvrqtpekrlewvafissgggrtsy pdtvkgrftisrddakntlylqmsslqsedtamyyctrhfyavldywgrgttltvss
Timeline for d1f4xh1: