SCOPe 2.05: Domain d2h17a_: 2h17 A:

Lineage for d2h17a_ (2h17 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)

8. Domain d2h17a_: 2h17 A: [204501]
   automated match to d1mr3f_
   complexed with gdp, unx

Details for d2h17a_

PDB Entry: 2h17, 1.7 Å

PDB Description: structure of human adp-ribosylation factor-like 5 (arl5)

PDB Compounds: (A:) ADP-ribosylation factor-like protein 5A

SCOPe Domain Sequences for d2h17a_:

Sequence; same for both SEQRES and ATOM records:

>d2h17a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrflmwdiggqeslrs
swntyytntefvivvvdstdrerisvtreelykmlahedlrkagllifankqdvkecmtv
aeisqflkltsikdhqwhiqaccaltgeglcqglewmmsr

Timeline for d2h17a_:

• d2h17a_ first appeared in SCOPe 2.03
  
• d2h17a_ appears in SCOPe 2.04
  
• d2h17a_ appears in SCOPe 2.06
  
• d2h17a_ appears in the current release, SCOPe 2.08