SCOP 1.67: Domain d1f4xl1: 1f4x L:1-110

Lineage for d1f4xl1 (1f4x L:1-110)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)

8. Domain d1f4xl1: 1f4x L:1-110 [20450]
   Other proteins in same PDB: d1f4xh1, d1f4xh2, d1f4xl2
   part of anti-carbohydrate Fab S-20-4
   complexed with mgs

Details for d1f4xl1

PDB Entry: 1f4x, 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4xl1:

Sequence; same for both SEQRES and ATOM records:

>d1f4xl1 b.1.1.1 (L:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
qavvtqesalttspgetvtltcrsstgtvttsnyanwvqekpdhlftgligatnnraagv
pvrfsgsliggkaaltitgaqtedeaiyfcalwysghwvfgggtkltvlg

Timeline for d1f4xl1:

• d1f4xl1 first appeared (with stable ids) in SCOP 1.55
  
• d1f4xl1 appears in SCOP 1.65
  
• d1f4xl1 appears in SCOP 1.69
  
• d1f4xl1 appears in the current release, SCOPe 2.08