Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
Protein Ligand-binding domain of neurexin 1beta [49949] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [225079] (1 PDB entry) |
Domain d2h0bc1: 2h0b C:279-475 [204491] Other proteins in same PDB: d2h0bc2 automated match to d2r1di1 complexed with ca, gol |
PDB Entry: 2h0b (more details), 2.1 Å
SCOPe Domain Sequences for d2h0bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0bc1 b.29.1.4 (C:279-475) Ligand-binding domain of neurexin 1beta {Cow (Bos taurus) [TaxId: 9913]} keeyiatfkgseyfcydlsqnpiqsssdeitlsfktlqrnglmlhtgksadyvnlalkng avslvinlgsgafealvepvngkfndnawhdvkvtrnlrqvtisvdgiltttgytqedyt mlgsddffyvggspstadlpgspvsnnfmgclkevvyknndvrlelsrlakqgdpkmkih gv
Timeline for d2h0bc1: