Lineage for d1qnzh_ (1qnz H:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288122Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1288338Domain d1qnzh_: 1qnz H: [20449]
    Other proteins in same PDB: d1qnzl_
    part of anti-HIV Fv 0.5B

Details for d1qnzh_

PDB Entry: 1qnz (more details)

PDB Description: nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide
PDB Compounds: (H:) 0.5b antibody (heavy chain)

SCOPe Domain Sequences for d1qnzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelvkpgasvkmsckasgytfttypiewmkqnhgkslewignfhpysddtny
nekfkgkakltvekssstvylefsrltsddsavyycaihygsayamdywgqgtsvtvss

SCOPe Domain Coordinates for d1qnzh_:

Click to download the PDB-style file with coordinates for d1qnzh_.
(The format of our PDB-style files is described here.)

Timeline for d1qnzh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qnzl_