Lineage for d1qnzl_ (1qnz L:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289056Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)
  8. 1289097Domain d1qnzl_: 1qnz L: [20448]
    Other proteins in same PDB: d1qnzh_
    part of anti-HIV Fv 0.5B

Details for d1qnzl_

PDB Entry: 1qnz (more details)

PDB Description: nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide
PDB Compounds: (L:) 0.5b antibody (light chain)

SCOPe Domain Sequences for d1qnzl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnzl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsrtdftlnihpveeedaatyycqqsnedpftfgsgtkleikr

SCOPe Domain Coordinates for d1qnzl_:

Click to download the PDB-style file with coordinates for d1qnzl_.
(The format of our PDB-style files is described here.)

Timeline for d1qnzl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qnzh_