Lineage for d1qnzl_ (1qnz L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7116Species Anti-HIV Fv 0.5B, (mouse), kappa L chain [48897] (1 PDB entry)
  8. 7118Domain d1qnzl_: 1qnz L: [20448]

Details for d1qnzl_

PDB Entry: 1qnz (more details)

PDB Description: nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide

SCOP Domain Sequences for d1qnzl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnzl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anti-HIV Fv 0.5B, (mouse), kappa L chain}
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsrtdftlnihpveeedaatyycqqsnedpftfgsgtkleikr

SCOP Domain Coordinates for d1qnzl_:

Click to download the PDB-style file with coordinates for d1qnzl_.
(The format of our PDB-style files is described here.)

Timeline for d1qnzl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qnzh_