Lineage for d1deed1 (1dee D:1501-1621)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7826Species Fab of human IgM RF 2A2 [48896] (1 PDB entry)
  8. 7830Domain d1deed1: 1dee D:1501-1621 [20445]
    Other proteins in same PDB: d1deea2, d1deeb2, d1deec2, d1deed2, d1deee2, d1deef2, d1deeg_, d1deeh_

Details for d1deed1

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deed1 b.1.1.1 (D:1501-1621) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

SCOP Domain Coordinates for d1deed1:

Click to download the PDB-style file with coordinates for d1deed1.
(The format of our PDB-style files is described here.)

Timeline for d1deed1: