Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (31 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [225303] (1 PDB entry) |
Domain d2gpca1: 2gpc A:1-84 [204438] Other proteins in same PDB: d2gpca2, d2gpcb2 automated match to d1isca1 complexed with fe2, mg |
PDB Entry: 2gpc (more details), 1.9 Å
SCOPe Domain Sequences for d2gpca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpca1 a.2.11.0 (A:1-84) automated matches {Trypanosoma cruzi [TaxId: 5693]} mfsipplpwgydglaakglskqqvtlhydkhhqgyvtklnaaaqtnsalatksieeiirt ekgpifnlaaqifnhtfywesmcp
Timeline for d2gpca1: