Lineage for d2gpca1 (2gpc A:1-84)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719324Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1719325Protein automated matches [226859] (31 species)
    not a true protein
  7. 1719484Species Trypanosoma cruzi [TaxId:5693] [225303] (1 PDB entry)
  8. 1719485Domain d2gpca1: 2gpc A:1-84 [204438]
    Other proteins in same PDB: d2gpca2, d2gpcb2
    automated match to d1isca1
    complexed with fe2, mg

Details for d2gpca1

PDB Entry: 2gpc (more details), 1.9 Å

PDB Description: The crystal structure of the enzyme Fe-superoxide dismutase from Trypanosoma cruzi
PDB Compounds: (A:) iron superoxide dismutase

SCOPe Domain Sequences for d2gpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpca1 a.2.11.0 (A:1-84) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mfsipplpwgydglaakglskqqvtlhydkhhqgyvtklnaaaqtnsalatksieeiirt
ekgpifnlaaqifnhtfywesmcp

SCOPe Domain Coordinates for d2gpca1:

Click to download the PDB-style file with coordinates for d2gpca1.
(The format of our PDB-style files is described here.)

Timeline for d2gpca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gpca2