SCOPe 2.04: Domain d2gpca1: 2gpc A:1-84

Lineage for d2gpca1 (2gpc A:1-84)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [225303] (1 PDB entry)

8. Domain d2gpca1: 2gpc A:1-84 [204438]
   Other proteins in same PDB: d2gpca2, d2gpcb2
   automated match to d1isca1
   complexed with fe2, mg

Details for d2gpca1

PDB Entry: 2gpc, 1.9 Å

PDB Description: The crystal structure of the enzyme Fe-superoxide dismutase from Trypanosoma cruzi

PDB Compounds: (A:) iron superoxide dismutase

SCOPe Domain Sequences for d2gpca1:

Sequence; same for both SEQRES and ATOM records:

>d2gpca1 a.2.11.0 (A:1-84) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mfsipplpwgydglaakglskqqvtlhydkhhqgyvtklnaaaqtnsalatksieeiirt
ekgpifnlaaqifnhtfywesmcp

Timeline for d2gpca1:

• d2gpca1 first appeared in SCOPe 2.03
  
• d2gpca1 appears in SCOPe 2.05
  
• d2gpca1 appears in the current release, SCOPe 2.08