SCOP 1.59: Domain d1deeb1: 1dee B:501-621

Lineage for d1deeb1 (1dee B:501-621)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab of human IgM RF 2A2 [48896] (2 PDB entries)

8. Domain d1deeb1: 1dee B:501-621 [20443]
   Other proteins in same PDB: d1deea2, d1deeb2, d1deec2, d1deed2, d1deee2, d1deef2, d1deeg_, d1deeh_

Details for d1deeb1

PDB Entry: 1dee, 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deeb1:

Sequence; same for both SEQRES and ATOM records:

>d1deeb1 b.1.1.1 (B:501-621) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

Timeline for d1deeb1:

• d1deeb1 first appeared (with stable ids) in SCOP 1.55
  
• d1deeb1 appears in SCOP 1.57
  
• d1deeb1 appears in SCOP 1.61
  
• d1deeb1 appears in the current release, SCOPe 2.08