Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab of human IgM RF 2A2 [48896] (2 PDB entries) |
Domain d1deea1: 1dee A:1-107 [20442] Other proteins in same PDB: d1deea2, d1deeb2, d1deec2, d1deed2, d1deee2, d1deef2, d1deeg_, d1deeh_ |
PDB Entry: 1dee (more details), 2.7 Å
SCOP Domain Sequences for d1deea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deea1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2} diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveik
Timeline for d1deea1: