![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab of human IgM RF 2A2 [48896] (1 PDB entry) |
![]() | Domain d1deea1: 1dee A:1-107 [20442] Other proteins in same PDB: d1deea2, d1deeb2, d1deec2, d1deed2, d1deee2, d1deef2, d1deeg_, d1deeh_ |
PDB Entry: 1dee (more details), 2.7 Å
SCOP Domain Sequences for d1deea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deea1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2} diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveik
Timeline for d1deea1: